Menu

Recombinant Helicobacter pylor DNA protection during starvation protein(dps)

Information

Catalog number

RPC20384

Full name

Recombinant Helicobacter pylor DNA protection during starvation protein(dps)

Size

1 mg

Price

1599.00 €

Go to shop   

Details

Verified reactivity

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Protein number

P43313

Gene number

dps

Other name

Bacterioferritin; HP-NAP; Neutrophil-activating protein A; Short name:NAP A

Protein origin

E.coli

Protein region

1-144aa

Protein sequence

MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Information about sequence

Full Length

Expected molecular weight

31.84kDa

Protein purity

≥ 90%

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Use before

1 year

Shipping requirements

Blue ice

Estimated production time

7-11 business days

Notes

For research use only. Not for diagnostic procedures.

Disease

helicobacter

Additional disease

Helicobacter pillory antibodies and ELISA kits as diagnostic to detect Gram-negative helicobacter bacteria genus name Helicobacter.

Source

Recombinants or rec. proteins

Group

recombinants